Description | Uncharacterized protein |
Sequence | MKETYFPEINEMYQRIAAKLQQHDSHPQQPKSEQLEKLEVFKAMLERLITFLQVSKNKITPSFKEKLGSNEKHIVSFLNPGRSGSQFLIYSEDNFPSLMCNLCSNPSLQFLNCSPMKIN |
Length | 119 |
Position | Tail |
Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.530 |
Instability index | 50.01 |
Isoelectric point | 8.45 |
Molecular weight | 13798.78 |
Publications | PubMed=16973872 |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro transcription coactivator activity GO:0003713 IEA:InterPro |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP22915 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.55| 17| 32| 61| 79| 1 --------------------------------------------------------------------------- 61- 79 (25.65/18.70) PSFKEKLGSNEKhiVSFLN 96- 112 (32.90/17.92) PSLMCNLCSNPS..LQFLN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QFLIYSE 2) RIAAKLQQHDSH | 86 15 | 92 26 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab