Description | Uncharacterized protein |
Sequence | MIKVMKETYFPEINEMYQRIAAKLQQHDSHPQQPKSEQLEKLEVFKAMLERLITFLQVSKNKITPSFKEKLGSNEKHIVSFLNPGRSGSQFLIYSEDNFPSLMCNLCSNPSLQFLNCSPMKIN |
Length | 123 |
Position | Tail |
Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.459 |
Instability index | 47.33 |
Isoelectric point | 8.79 |
Molecular weight | 14270.43 |
Publications | PubMed=16973872 |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central transcription coactivator activity GO:0003713 IEA:InterPro |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP22914 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 83.05| 19| 32| 65| 83| 1 --------------------------------------------------------------------------- 45- 57 (16.15/ 6.61) ..FKAML....ERLITFLQ 65- 83 (34.00/20.39) PSFKEKLGSNEKHIVSFLN 100- 116 (32.90/19.54) PSLMCNLCSNPS..LQFLN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KHIVSFL 2) QFLIYSE | 76 90 | 82 96 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab