| Description | Uncharacterized protein |
| Sequence | MIKVMKETYFPEINEMYQRIAAKLQQHDSHPQQPKSEQLEKLEVFKAMLERLITFLQVSKNKITPSFKEKLGSNEKHIVSFLNPGRSGSQFLIYSEDNFPSLMCNLCSNPSLQFLNCSPMKIN |
| Length | 123 |
| Position | Tail |
| Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.459 |
| Instability index | 47.33 |
| Isoelectric point | 8.79 |
| Molecular weight | 14270.43 |
| Publications | PubMed=16973872 |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central transcription coactivator activity GO:0003713 IEA:InterPro |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP22914
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 83.05| 19| 32| 65| 83| 1
---------------------------------------------------------------------------
45- 57 (16.15/ 6.61) ..FKAML....ERLITFLQ
65- 83 (34.00/20.39) PSFKEKLGSNEKHIVSFLN
100- 116 (32.90/19.54) PSLMCNLCSNPS..LQFLN
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) KHIVSFL 2) QFLIYSE | 76 90 | 82 96 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab