<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22913
| Description |
Uncharacterized protein |
| Sequence | MAAASCTVWDSVLELTKSAQVKNCDPQLWAIQLSSNLNSAGVDLPSMELAHLLVSHICFDNHMPITWKFLEKALSFNLVPPLLVLALLSTRVVPNRLHIGCIWNS |
| Length | 105 |
| Position | Tail |
| Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.443 |
| Instability index | 44.59 |
| Isoelectric point | 6.38 |
| Molecular weight | 11608.52 |
| Publications | PubMed=16973872
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22913
No repeats found
No repeats found
|