<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22902
| Description |
Uncharacterized protein (Fragment) |
| Sequence | IYLEFFILKQKMNNQINSPAGYYQQGSMHPGQPPQQVMVQSQSIPPQNPIATSNMMPGQSNDQFYPDPEIKNDGLIDPIQKSKDMMNQLKNSLQALMGQLVIALNPPSETNPFQTENHYQLLGKQIENFNRACDLLTVNLKVACESQEISNELKNFSRYYAHISQIDANRLENPFINSINIHMQRIGEFQNLILQYLAPKNLNQTEN |
| Length | 207 |
| Position | Tail |
| Organism | Brachionus plicatilis (Marine rotifer) (Brachionus muelleri) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Gnathifera> Rotifera> Eurotatoria>
Monogononta> Pseudotrocha> Ploima> Brachionidae> Brachionus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.613 |
| Instability index | 63.52 |
| Isoelectric point | 5.53 |
| Molecular weight | 23681.57 |
| Publications | PubMed=30375419
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22902
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.80| 10| 61| 45| 54| 1
---------------------------------------------------------------------------
45- 54 (20.91/ 9.82) PPQ..NPIATSN
106- 117 (16.89/ 6.74) PPSetNPFQTEN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.71| 12| 24| 120| 131| 4
---------------------------------------------------------------------------
120- 131 (20.63/12.67) QLLGKQIENFNR
147- 158 (20.08/12.16) QEISNELKNFSR
---------------------------------------------------------------------------
|