<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22893
Description |
Uncharacterized protein (Fragment) |
Sequence | EIQKALGEGKSLYPCLELSTSIAHGAPVVEILQHQLYYTINPQVILHLNFQALFSFKCVGCGFHLKEETENVFLPPCWRTFEDLSPYHYQCRP |
Length | 93 |
Position | Tail |
Organism | Pocillopora damicornis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Scleractinia>
Astrocoeniina> Pocilloporidae> Pocillopora.
|
Aromaticity | 0.13 |
Grand average of hydropathy | -0.058 |
Instability index | 46.13 |
Isoelectric point | 5.90 |
Molecular weight | 10697.20 |
Publications | PubMed=30382153
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22893
No repeats found
No repeats found
|