<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22893
| Description |
Uncharacterized protein (Fragment) |
| Sequence | EIQKALGEGKSLYPCLELSTSIAHGAPVVEILQHQLYYTINPQVILHLNFQALFSFKCVGCGFHLKEETENVFLPPCWRTFEDLSPYHYQCRP |
| Length | 93 |
| Position | Tail |
| Organism | Pocillopora damicornis |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Scleractinia>
Astrocoeniina> Pocilloporidae> Pocillopora.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.058 |
| Instability index | 46.13 |
| Isoelectric point | 5.90 |
| Molecular weight | 10697.20 |
| Publications | PubMed=30382153
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22893
No repeats found
No repeats found
|