<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22887
| Description |
Uncharacterized protein |
| Sequence | MAGALGGMFGSQAPGPPPPGPPGPPGLIPPPAGPRNPNNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLSKLRHWQQVLEDISVQHKKPAEMPQGPLAYLEQASANIPAPMKQT |
| Length | 175 |
| Position | Head |
| Organism | Hirundo rustica rustica |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Sylvioidea> Hirundinidae>
Hirundo.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.534 |
| Instability index | 58.57 |
| Isoelectric point | 5.42 |
| Molecular weight | 19256.73 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22887
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.72| 15| 16| 102| 116| 1
---------------------------------------------------------------------------
102- 116 (25.06/16.78) QKPEQVIKEDVSELR
120- 134 (24.66/16.42) QRKEALIQKHLSKLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.14| 14| 18| 140| 155| 2
---------------------------------------------------------------------------
140- 155 (21.65/18.02) LEDISvqHKKPAEMPQ
161- 174 (25.49/14.54) LEQAS..ANIPAPMKQ
---------------------------------------------------------------------------
|