<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22882
Description |
Uncharacterized protein |
Sequence | MAGALGGMFGSQAPGPPPGPPGPPGLIPPPAGPRNPNSTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLSKLRHWQQVLEDISVQHKKPAEMPQGPLAYLEQASANIPAPMKQT |
Length | 174 |
Position | Head |
Organism | Chloebia gouldiae (Gouldian finch) (Erythrura gouldiae) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Passeroidea> Estrildidae>
Erythrura.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.512 |
Instability index | 58.23 |
Isoelectric point | 5.42 |
Molecular weight | 19132.59 |
Publications | PubMed=30282656
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22882
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.72| 15| 16| 101| 115| 1
---------------------------------------------------------------------------
101- 115 (25.06/19.12) QKPEQVIKEDVSELR
119- 133 (24.66/18.72) QRKEALIQKHLSKLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.14| 14| 18| 139| 154| 2
---------------------------------------------------------------------------
139- 154 (21.65/17.00) LEDISvqHKKPAEMPQ
160- 173 (25.49/13.73) LEQAS..ANIPAPMKQ
---------------------------------------------------------------------------
|