<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22876
| Description |
Uncharacterized protein |
| Sequence | MGFDGKFGRGPRELSGAVDLISRYKLLNHHSFFCKKPLPLAISDTNYLNNVVGDTEIRKGEGMELDQLFQNSYPNGEDGLHSALRHGNTRTSISAARNCTSRFAFCKICSVGIFMSLVVLTLPSYRSNLHSKKAEKGTPTISGKPKIKSKDKVKKHKKHKEKDRDKEKEQKKHKHRHKDRSKDKDKDKDKENKKDKSGNHESGGDHSKKHEKKRKQEVTGSSASVQNHKKSTIPYNLINIS |
| Length | 241 |
| Position | Head |
| Organism | Panicum miliaceum (Proso millet) (Broomcorn millet) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.179 |
| Instability index | 24.25 |
| Isoelectric point | 9.90 |
| Molecular weight | 27288.70 |
| Publications | PubMed=30683860
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22876
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 115.13| 21| 21| 154| 174| 1
---------------------------------------------------------------------------
132- 157 (23.39/ 7.80) KKAEKGtptiSGKPKIKSKDK......vKKHK
158- 178 (38.28/17.12) KHKEKD....RDKEKEQKKHK.......HRHK
180- 207 (27.10/10.12) RSKDKD....KDKDKENKKDKsgnhesgGDHS
208- 229 (26.36/ 9.66) KKHEKK....RKQEVTGSSAS......vQNHK
---------------------------------------------------------------------------
|