| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MDSAAPNPSAAAVAAAAAGNGVQASGAGGERPEDASKQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAELDTMQKLAEGCDIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEQAFPEDVEQYREIRASSAAEAKRLAQSQSTLPNGDVKVKAEH |
| Length | 190 |
| Position | Middle |
| Organism | Panicum miliaceum (Proso millet) (Broomcorn millet) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Panicodae> Paniceae> Panicinae> Panicum. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.377 |
| Instability index | 33.63 |
| Isoelectric point | 5.12 |
| Molecular weight | 20248.47 |
| Publications | PubMed=30683860 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP22861
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.68| 15| 17| 51| 65| 1
---------------------------------------------------------------------------
51- 65 (25.44/16.71) LGLLHQLNLTVSSFN
70- 84 (24.25/15.65) LPLLQRLNALVAELD
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) APNPSAAAVAAAA 2) EQYREIRA | 5 156 | 17 163 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab