<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22858

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMMQSHLPSPARLGLTASSPSLPPNPSPLNPTSSPPHGNLPASATAGAGAAPTLTTSPSLLPLLPPLPRAQSLLQLISSLASNLFELSPNRAAWISAYRGSLPTFLPSASSSPPPLPTPISSTKDALSLLTALQTQLFEAVAELQETLDLQDARARLAREARAKDAALLAFAKKLHEAHHVLDRLVDDYADYRRDPKRPRGAAAADDPEPVSDGDFGASLHSRLKLDDILSYAYRISCTTFAPPEHGAGLPLRGALPPAPQEHEMRASKLYQCADLDVGVPKKPLEAEGITAEVEAMPLYEPPPQEGAPRIPNTLPPMFPKELKPPPGWKPGDPITLPLDDILPAVKGEEPQAPVPQVPVSVRPVAPMGPEPIQVKPVQLDFESSSSDEYSSDVGSSEEDDED
Length402
PositionMiddle
OrganismPanicum miliaceum (Proso millet) (Broomcorn millet)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Panicodae> Paniceae> Panicinae> Panicum.
Aromaticity0.04
Grand average of hydropathy-0.353
Instability index60.80
Isoelectric point4.87
Molecular weight42744.86
Publications
PubMed=30683860

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	RuleBase:RU364141
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP22858
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     203.44|      35|      39|     296|     330|       1
---------------------------------------------------------------------------
   21-   51 (46.66/12.14)	LP.....P.....NP.....SPLNPTSSPPHgnLPASATAG.A.GAAP
   60-   95 (41.66/10.15)	LPLLP..P.....LPraQSLLQLISSLASNL..F..ELSPNrA.AWIS
  296-  330 (70.90/21.84)	MPLYE..P.....PP..QEGAPRIPNTLPPM..FPKELKPP.P.GWKP
  336-  376 (44.22/11.17)	LPLDDilPavkgeEP..QAPVPQVPVSVRPV..AP..MGPE.PiQVKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      85.12|      29|      37|     123|     153|       2
---------------------------------------------------------------------------
  123-  153 (38.74/36.92)	KDAlSLLtALQTQLFEAVAELQETL.DLQDAR
  163-  192 (46.38/33.13)	KDA.ALL.AFAKKLHEAHHVLDRLVdDYADYR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      89.10|      28|      50|     198|     226|       3
---------------------------------------------------------------------------
  198-  226 (45.89/28.76)	PRGAA.....AADDPEPvSDGDFGAS.LHSRLKLD
  243-  276 (43.20/22.65)	PEHGAglplrGALPPAP.QEHEMRASkLYQCADLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.90|      11|     134|      96|     106|       5
---------------------------------------------------------------------------
   96-  106 (22.78/14.07)	AYRGSLPTFLP
  232-  242 (23.13/14.39)	AYRISCTTFAP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP22858 with Med4 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) KKPLEAEGITAEVEAMPLYEPPPQEGAPRIPNTLPPMFPKELKPPPGWKPGDPITLPLDDILPAVKGEEPQAPVPQVPVSVRPVAPMGPEPIQVKPVQLDFESSSSDEYSSDVGSSEEDDED
2) MMQSHLPSPARLGLTASSPSLPPNPSPLNPTSSPPHGNLPASATAGAGAAP
281
1
402
51

Molecular Recognition Features

MoRF SequenceStartStop
1) EPIQVKPVQLDFE
370
382