<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22855
| Description |
Mediator of RNA polymerase II transcription subunit 32 |
| Sequence | MEATVDDLSAAYDEFVAAASAVVEARAQSGGEKTAATDAALEAFKQRWELFRVACDHAEELVESIRQRIGSECLVDEATGSASSGSGPAPLAAAPGIKPISAVRLEQMSKAVRWLVIELQHGAGGASAPGAAGSGGASTPNAGAGLGPGGQHPDEGGQ |
| Length | 158 |
| Position | Tail |
| Organism | Panicum miliaceum (Proso millet) (Broomcorn millet) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.126 |
| Instability index | 46.89 |
| Isoelectric point | 4.63 |
| Molecular weight | 15768.20 |
| Publications | PubMed=30683860
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22855
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.21| 15| 15| 14| 28| 1
---------------------------------------------------------------------------
14- 28 (23.74/16.71) EFVAAASAVVEARAQ
32- 46 (24.47/17.46) EKTAATDAALEAFKQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.88| 21| 44| 74| 95| 2
---------------------------------------------------------------------------
74- 94 (36.33/17.72) LVDEAT.....GSASSGSGPAPLAAA
119- 144 (32.55/10.83) LQHGAGgasapGAAGSGGASTPNAGA
---------------------------------------------------------------------------
|