<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22848
Description |
Mediator of RNA polymerase II transcription subunit 19a-like |
Sequence | MSSSNQMGSDGKFGRGPRELSGAVDLISRYKLLNHHSFFCKKPLPLAISDTNYLNNVVGDTEIRKGEGMELDQLFQNSYPNEKTAYIQPFDMETLGQAFQLRETAPVDLPSAEKGTPTISGKPKIKSKDKVKKHKKHKEKDRDKEKEQKKHKHRHKDRSKDKDKDKDKDKEKKKDKSGNHESGGDHSKKHEKKRKQEVTGSSASVQNHKKTQKHKNQ |
Length | 217 |
Position | Head |
Organism | Panicum miliaceum (Proso millet) (Broomcorn millet) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -1.572 |
Instability index | 24.76 |
Isoelectric point | 9.76 |
Molecular weight | 24825.67 |
Publications | PubMed=30683860
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP22848
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.98| 21| 21| 137| 157| 1
---------------------------------------------------------------------------
137- 157 (39.21/15.25) HKEKDRDKEKEQKKHKHRHKD
161- 181 (32.77/11.65) DKDKDKDKDKEKKKDKSGNHE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.46| 14| 19| 182| 196| 2
---------------------------------------------------------------------------
182- 196 (21.16/14.16) SGGDHsKKHEKKRKQ
204- 217 (25.30/12.65) SVQNH.KKTQKHKNQ
---------------------------------------------------------------------------
|