<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22846
| Description |
Mediator of RNA polymerase II transcription subunit 9-like |
| Sequence | MDHHHPQQPQQYGDPYRGLVPSPQPDHHLHALQYHHQPQPALMSPPQPQPQPGLMSPPQPQPQPGLMSPPQPQPQPGLMSPPQPQPGLMSPPQPQQHHHASLASHFHLLHLVTRLADTIGTGTRDQNFDALVEELTSQFARCQQLLNSISGTISSKSTTVEGQRQSLDETRQLLDQRKELITKYRSSVEDLLKGDTR |
| Length | 197 |
| Position | Middle |
| Organism | Panicum miliaceum (Proso millet) (Broomcorn millet) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.947 |
| Instability index | 82.47 |
| Isoelectric point | 6.51 |
| Molecular weight | 22020.43 |
| Publications | PubMed=30683860
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22846
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 105.67| 21| 21| 37| 57| 1
---------------------------------------------------------------------------
37- 57 (52.22/15.81) QPQPALMSPPQPQPQPGLMSP
61- 81 (53.45/16.32) QPQPGLMSPPQPQPQPGLMSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.92| 25| 31| 95| 119| 4
---------------------------------------------------------------------------
95- 119 (44.03/25.37) QQHHHA...SLASHF.HLLHLVTRLADTI
125- 153 (33.89/18.21) DQNFDAlveELTSQFaRCQQLLNSISGTI
---------------------------------------------------------------------------
|