<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22823
| Description |
Uncharacterized protein |
| Sequence | MQSLTWKVRTRIIGEICSALAFIHSQKPYPIVHGDLNLGNILLDANFVSKLGDLGICQFLPQSNITTINQQHHPTNYRGTLCYMDSDEFQSACELMLWSDVHSFGIIILRLLTGRSQHRIAEIVEEAMEKGNLHSIMDTSAGDWPLVQAKQLAHLGLRCITMSGGRQPDLGGEAWEVIEALMRDACLTAGPSEFASSSNDDSTPSCFICPIFQEVMNDPHIAADGFTYEATAIKGWLDSGADTSPMTNLRLAHRSLTPNRALRSAILEWQQHWK |
| Length | 274 |
| Position | Tail |
| Organism | Panicum miliaceum (Proso millet) (Broomcorn millet) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.134 |
| Instability index | 46.44 |
| Isoelectric point | 5.49 |
| Molecular weight | 30436.33 |
| Publications | PubMed=30683860
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
ubiquitin-protein transferase activity GO:0004842 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22823
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.17| 23| 98| 129| 157| 1
---------------------------------------------------------------------------
130- 157 (32.13/34.88) KGNLHSIMDTSagdwPLVQAKqLAHLGL
234- 256 (44.04/23.36) KGWLDSGADTS....PMTNLR.LAHRSL
---------------------------------------------------------------------------
|