<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22791
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MSLSLHCLLFFFRKCSAISSVLIDPPILQHVEALEVLLQGLSGVPKERVRVHELCLKSGPNLGVVPSEVRLLGDLAQATPSWTIRHVGGAMRGAGAEQISVLVRTVVESKASKNVLHYFYTLGYKLDHEILKIGFAFRFHRGAQITVTVTSANKMPRLHATDEAVPVTPGIQLVEITAPAAADNYNDVVSAVTAFCEFLAPLLHLSKPGHSTGIVTTAGAAAASLMSSGGGKTL |
| Length | 234 |
| Position | Head |
| Organism | Panicum miliaceum (Proso millet) (Broomcorn millet) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.324 |
| Instability index | 33.06 |
| Isoelectric point | 8.71 |
| Molecular weight | 24886.66 |
| Publications | PubMed=30683860
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22791
No repeats found
|