<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22789
| Description |
Uncharacterized protein |
| Sequence | MASEAARRRQELAAEGQRHLEETIAAAFQILVSMNDELCNAGLWSSSSVSAAAAAAAAVGPQHQHSATPPPPHSADYDAADAGGAPGPGGSLDEARHRYKSAVAALRASIAAVSSCAQDIGSTESEADHADIERLEEHASALRKEIESKNKHVKLLMDQLRELITDISMWQSPCSV |
| Length | 176 |
| Position | Head |
| Organism | Panicum miliaceum (Proso millet) (Broomcorn millet) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.345 |
| Instability index | 59.57 |
| Isoelectric point | 5.17 |
| Molecular weight | 18534.30 |
| Publications | PubMed=30683860
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22789
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.02| 19| 31| 79| 97| 1
---------------------------------------------------------------------------
52- 63 (20.76/ 8.41) AAAAAAAVGP.......QH
79- 97 (35.47/19.09) AADAGGAPGPGGSLDEARH
111- 129 (31.79/16.41) AAVSSCAQDIGSTESEADH
---------------------------------------------------------------------------
|