<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22785
Description |
Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MDIITQLQEQLSEIAMVAVNTFGTLQRDAPPDRLSSSYPDPLNPNPKPEEDAKPQVPAQPAAAAARARPRRAPQGHEPRPHTRRQEGLLKANYSHEWMMMKVET |
Length | 104 |
Position | Middle |
Organism | Panicum miliaceum (Proso millet) (Broomcorn millet) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.915 |
Instability index | 62.47 |
Isoelectric point | 6.83 |
Molecular weight | 11677.08 |
Publications | PubMed=30683860
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22785
No repeats found
No repeats found
|