<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22781
| Description |
Uncharacterized protein |
| Sequence | MASEAARRRQELAAEGQRHLEETIAAAFQILVSMNDELCNAGLWSSISVSAAAAAGPQHQHSATPPPPHSADSDAADAGGAPGPGGSLDEARHRYKSAVTALRTSIAAVSSCAQDIGSTESEADHAEMERLEERASALRKEIESKNKHIKLLMDQLRELIADISMWQSPCSV |
| Length | 172 |
| Position | Head |
| Organism | Panicum miliaceum (Proso millet) (Broomcorn millet) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.411 |
| Instability index | 58.34 |
| Isoelectric point | 5.20 |
| Molecular weight | 18267.09 |
| Publications | PubMed=30683860
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22781
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.81| 14| 24| 120| 133| 1
---------------------------------------------------------------------------
120- 133 (23.93/15.84) ESEADHAE..MERLEE
143- 158 (19.88/12.17) ESKNKHIKllMDQLRE
---------------------------------------------------------------------------
|