<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22770

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMPGVVMDNANIGGLRHGPGNTYPQDGLSHSRGEVAQFNGANAQDGPVHVNGVEKNASQSRSVEAIPSNHASRVTKGPPELPHITQGFFPFAKLVNRSVQQCWNDLSDLITEMAEMQVNSHEFHPSTAPTTGKSPGNQSPGNIRKKLRILEFSHAKRAEFIKLLVLSQWSRQAADVSKLIDIQNFIRTRHQAYTNALQWVGDMKRDLVQAQVANPDLKTALEVLSRGKVASMSDLGYKPPRRLTVRGTLRKLQKINRLIGARLVVQDEIPPPFKSYRVHDGRVTFGVPGEFELDLSIGEENENSQFFFVDIRFLFSPSPPILKGRLLNELEMTINDVLQNSGLTGCFDLLHNLVLTNKINILFKQATELARSSWSDGLRVELLHRTLVVQYWTLKPGTKSWLEIGIKSGHRKSDSESPGLPSLKFRWVRDGGEVPCEDIAFDAENLSMEIVLRSVIALHVSHTLSSAYCKIRQSSLFSTGFLSLRAHLTRTEPGDCQLDVQLTETRHLQVSIEPMSGVSILSANPTVSDRFDMERNPERSSVEDIVSRVARIRCNAAIEEIESKVKMLGFEPLNPRAWKLDIRRIFPPNVLRFTLFSHQLWGRNWIVAATSSMDGDSWWVVQLRPTLPAKGPPIPHANGCGQPILRSAQVVTDSFFPARYDIDDAYLANLGHSLSGILAIQSNARYLSDLQSIKFHPPPHKLKIEPDLRVPDILVRYDVSTLPSVFRVAMPAKAKKKSLIRDTIRLAFHGVDPREKCAIMVAYGNLVDSTATLCPLISSWDRSLVFQKGGTGFAMRLLAPAGHPVIVSLLENLQRLECVLSILETLQRKKVEIRTFSLSSISFIYGSERDLAASLNIHLSRNESLMKLSPTDLASRREFLFGLRLGIQFGLQNPHRRIQESLASSLNRSPTEAGLETVVELLTLTLPLMRALDQLMANPSHSGPLRLHVTVRNAKTYQLHYPGDEARFQLVAASHQNRLVWVLKDANSQGNSKNDDSITARLRQTLYTSKGDGWKGLETGVVAEVDQVGNLLRELEKCFVASRADPKHNSTDYAANHTGLNNPEISALAIKKGTTDGAKLSLSDSLTTLPNDKGNLSQADTAAQKEDIIMID
Length1111
PositionTail
OrganismAspergillus welwitschiae
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.06
Grand average of hydropathy-0.265
Instability index44.63
Isoelectric point9.10
Molecular weight123484.72
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	ARBA:ARBA00003669
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP22770
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.67|      19|      30|     684|     702|       1
---------------------------------------------------------------------------
  684-  702 (36.22/21.19)	RY.LSDLQSIKFHPPPHKLK
  715-  734 (26.45/13.53)	RYdVSTLPSVFRVAMPAKAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.62|      25|      31|     141|     168|       2
---------------------------------------------------------------------------
  141-  168 (36.33/36.02)	NIRKKLRILEFSHAKRAEFIKLLvlsQW
  174-  198 (43.29/33.23)	DVSKLIDIQNFIRTRHQAYTNAL...QW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      91.22|      28|      35|     923|     953|       3
---------------------------------------------------------------------------
  923-  953 (40.34/38.18)	LTLPLMRALDQLMAnPSHSGplRLHVTVRNA
  958-  985 (50.88/34.24)	LHYPGDEARFQLVA.ASHQN..RLVWVLKDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.90|      23|      35|     842|     864|       4
---------------------------------------------------------------------------
  842-  864 (38.93/22.89)	FIYGSERDLAASL.NIHLSRNESL
  878-  901 (36.96/21.38)	FLFGLRLGIQFGLqNPHRRIQESL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.60|      19|     320|     475|     499|       5
---------------------------------------------------------------------------
  272-  293 (31.35/13.88)	FKSYRVHDGRVTfgvPGEFELD
  480-  498 (36.25/19.84)	FLSLRAHLTRTE...PGDCQLD
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP22770 with Med14 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) VMDNANIGGLRHGPGNTYPQDGLSHSRGEVAQFNGANAQDGPVHVNGVEKNASQSRSVEAIPSNHASRVTKGPPE
5
79

Molecular Recognition Features

MoRF SequenceStartStop
1) KEDIIMI
2) KKLRIL
1104
144
1110
149