<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22763

Description Uncharacterized protein
SequenceMANKMVGKGKLPVESEDAQKLRFQVELEFVQCLANPNYLHFLAQRGYFKDAAFVNYLKYLLYWKEPEYAKYLKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNDPAIMPNSNNGTNNGSNANSNNGASVVGGISNNNGSSNNGPNSGSVSVPTSVGQQQQQQQNGAGITQHNGVGGGMLGNPMGSGGGIPGSGINQKVP
Length245
PositionMiddle
OrganismAnopheles farauti
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Anophelinae> Anopheles.
Aromaticity0.09
Grand average of hydropathy-0.387
Instability index30.93
Isoelectric point9.02
Molecular weight26350.35
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364129

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22763
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.91|      14|      17|     162|     175|       1
---------------------------------------------------------------------------
  162-  175 (25.63/12.55)	NNGSNANSNNGASV
  182-  195 (26.28/13.05)	NNGSSNNGPNSGSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      48.35|      11|      15|      29|      42|       2
---------------------------------------------------------------------------
   29-   42 (18.59/18.66)	FVQCLanpNYLHFL
   53-   60 (15.35/ 6.80)	FV......NYLKYL
   80-   89 (14.41/ 6.02)	FLDLL...QYEHF.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.04|      17|      79|     138|     157|       6
---------------------------------------------------------------------------
  124-  140 (28.89/17.33)	GTTSLTGLAVGGQPVGG
  144-  160 (30.16/10.78)	GTLLSNDPAIMPNSNNG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22763 with Med31 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GTLLSNDPAIMPNSNNGTNNGSNANSNNGASVVGGISNNNGSSNNGPNSGSVSVPTSVGQQQQQQQNGAGITQHNGVGGGMLGNPMGSGGGIPGSGINQKVP
144
245










Molecular Recognition Features






MoRF SequenceStartStop




NANANA