<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22763
| Description |
Uncharacterized protein |
| Sequence | MANKMVGKGKLPVESEDAQKLRFQVELEFVQCLANPNYLHFLAQRGYFKDAAFVNYLKYLLYWKEPEYAKYLKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNDPAIMPNSNNGTNNGSNANSNNGASVVGGISNNNGSSNNGPNSGSVSVPTSVGQQQQQQQNGAGITQHNGVGGGMLGNPMGSGGGIPGSGINQKVP |
| Length | 245 |
| Position | Middle |
| Organism | Anopheles farauti |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.387 |
| Instability index | 30.93 |
| Isoelectric point | 9.02 |
| Molecular weight | 26350.35 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22763
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.91| 14| 17| 162| 175| 1
---------------------------------------------------------------------------
162- 175 (25.63/12.55) NNGSNANSNNGASV
182- 195 (26.28/13.05) NNGSSNNGPNSGSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 48.35| 11| 15| 29| 42| 2
---------------------------------------------------------------------------
29- 42 (18.59/18.66) FVQCLanpNYLHFL
53- 60 (15.35/ 6.80) FV......NYLKYL
80- 89 (14.41/ 6.02) FLDLL...QYEHF.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.04| 17| 79| 138| 157| 6
---------------------------------------------------------------------------
124- 140 (28.89/17.33) GTTSLTGLAVGGQPVGG
144- 160 (30.16/10.78) GTLLSNDPAIMPNSNNG
---------------------------------------------------------------------------
|