<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22753
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDRTSSAPFRTGPPSPSPSSPAPFNSFKDSIYSTIPPEQIPQTPTSPPLMSVSAPNDASNLANVQASSQPPSQPASLSTPPSSVPMTTQSSQQPTAGVTNSFPTPASSVDPDHMDKSFGAGFSEAGVPNTNSASVAPVQQSEHRRTDHNRDFASAEAGTGVRDFAQMGGSTQPPQGDAMELDTKTPAQTNSNWPSLESLQKDFSSAFHLCKSSHIATGPDPSVDLISLYGLGPIAKSVVRNDPVTGAKINRLRKSYEGKLKGLGLAGRNKPVKHDPSMPGGLRQMTMWPEEEWQNQKVFGKEIKVADIDSALYNMQLKAMKMEPGTVPNNDYWEDVLGHDKPAKSSAGDGPKKTPTSATAPRAVGQPNGTSMPADSERGRPSRGRKRHYDDNSFVGYGEGYADDDDDSAFYSNGEGGGKKKRKKDHVPRISAPPDRGGSYGVGMFGIGAR |
Length | 451 |
Position | Head |
Organism | Aspergillus mulundensis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.817 |
Instability index | 50.33 |
Isoelectric point | 7.14 |
Molecular weight | 47899.33 |
Publications | PubMed=30018880
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP22753
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 65.78| 11| 31| 12| 22| 2
---------------------------------------------------------------------------
12- 22 (23.50/ 8.57) TGPPSPSPSSP
35- 45 (21.60/ 7.30) TIPPEQIPQTP
46- 56 (20.68/ 6.70) TSPPLMSVSAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.72| 28| 31| 97| 127| 3
---------------------------------------------------------------------------
97- 121 (35.33/16.97) ....AGVTNsF.P.TPASSVDP.........DHMDKSFGA
124- 155 (21.75/ 8.69) SEAG.......vPnTNSASVAPvqqsehrrtDH.NRDFAS
156- 178 (35.63/11.31) AEAGTGVRD.F.A.QMGGSTQP.........PQGD.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 100.85| 28| 30| 343| 370| 4
---------------------------------------------------------------------------
343- 370 (50.20/23.25) PAKSSAGDGPKKTPTSATAPRAVGQPNG
374- 401 (50.65/23.53) PADSERGRPSRGRKRHYDDNSFVGYGEG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.85| 16| 31| 229| 244| 5
---------------------------------------------------------------------------
229- 244 (29.80/16.50) LYGLGPIAKS.VVRNDP
261- 277 (26.05/13.56) LKGLGLAGRNkPVKHDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.59| 19| 37| 283| 303| 7
---------------------------------------------------------------------------
283- 303 (33.56/26.90) LRQMTMWP.....EEEWQNqkVFGKE
318- 341 (31.03/18.35) LKAMKMEPgtvpnNDYWED..VLGHD
---------------------------------------------------------------------------
|