Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MSDPRLRQEDLKTLEQTRQKLFTLSHNIGSLRNEMMRSNPLPDWASLQTSAAILARNLQNLTDHLSGNADLLERTVVYPSTNYPGRTQENLLVQLVRKRLEPPVEEWVAEGRAIEGNTKDEEDFSKWAQGWIGERIATYAMEEGGDNFTAEEREMGIENVRTGLRRKFEDDEESEEEEDDEDEDRDQKMENTLEGELDVTVVRKSGMGPTEFELGQIKTQKKRDGPVRSFEDILEFSTRGEVLPKQEMRR |
Length | 250 |
Position | Head |
Organism | Coleophoma cylindrospora |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Dermateaceae> Coleophoma. |
Aromaticity | 0.06 |
Grand average of hydropathy | -1.014 |
Instability index | 58.14 |
Isoelectric point | 4.65 |
Molecular weight | 28876.62 |
Publications | PubMed=30018880 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP22751 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 232.64| 61| 61| 110| 170| 1 --------------------------------------------------------------------------- 73- 106 (32.94/11.09) ........................ERTVVYP....STNYPGRTQEnLLVQLVRKRLEPPVEE 110- 170 (103.13/46.38) EGRAIEGNTKDEEDFSKWAQGWIGERIATYAMEEGGDNFTAEERE.MGIENVRTGLRRKFED 172- 232 (96.56/43.08) EESEEEEDDEDEDRDQKMENTLEGELDVTVVRKSGMGPTEFELGQ.IKTQKKRDGPVRSFED --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PVRSFEDILEFSTRGEVLPKQEMRR 2) TEFELGQIKTQKKRD | 226 210 | 250 224 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab