<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22747

Description Putative RNA polymerase II holoenzyme cyclin-like subunit
SequenceMAASYWESSQRRFWTFSREQLDNVRQKLEEEDQNLVQSYPLPELRHLSFYFNQQIARLGKRLGVRQQAMATAQLYLRRFYTKVEIRRTNPYLVIATAVYLAYFFSSDTSKLGECEFFLISEMSSQMIVHHPYRTLTSLQGNFSLTQEESALAWSIINDHYMTDLPLLYAPHIIAVMAILLALVLRPNTTGIQSASNSASNIATAAQAALNSASQPRPATGDRQSGPRTKVQKLANWLAESNIDIEGIVNCTQEMISFYEFQEQYNEKHTREQINRFVKARGLDK
Length284
PositionKinase
OrganismColeophoma cylindrospora
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Dermateaceae> Coleophoma.
Aromaticity0.11
Grand average of hydropathy-0.352
Instability index59.88
Isoelectric point8.45
Molecular weight32620.61
Publications
PubMed=30018880

Function

Annotated function 
GO - Cellular Component
integral component of membrane	GO:0016021	IEA:UniProtKB-KW
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22747
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.92|      11|      23|      69|      80|       1
---------------------------------------------------------------------------
   69-   80 (17.74/15.44)	MATAqLYLRRFY
   94-  104 (20.18/11.72)	IATA.VYLAYFF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.17|      23|      25|     108|     132|       2
---------------------------------------------------------------------------
  108-  132 (37.75/22.94)	TSKLGecEFFLISEMSS..QMIVHHPY
  136-  160 (37.42/17.15)	TSLQG..NFSLTQEESAlaWSIINDHY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     103.86|      30|      33|       4|      33|       3
---------------------------------------------------------------------------
    4-   33 (52.58/29.53)	SYWESSQRRFWTFSREQLDNVRQKLEEEDQ
   38-   67 (51.28/28.66)	SYPLPELRHLSFYFNQQIARLGKRLGVRQQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22747 with CycC domain of Kingdom Fungi
Unable to open file!