<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22745
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSFDHPHTPQSPSNLSSTNLPPKPTSPQTTTSLPTPAHSINGSLSSSLGSDMASDQAQFEDGSHKRKRDLEDHGNQEQKKVHVEDSRFGIDDLHIDVGPKYLLCKTPHEYVRPNPTHDFFALYGLYGIASTVSRFKPDGEKNVLRKSYKGQLKAAGISGTWDAVKKDTFSTEALFGMMMVPQEEWDMQFRGKEIEKGIPEAARASLGKAMTMAKGNISRDDWDHKVLGELVVKEKTGAEKARVGVKTAHAVTQNPAVSKAVKGEIPRPKRNIKKRTYGDTSFEGYGEGYVDDEQELDDGGYSTGDGGAGQKRRKKVGIVPEVVIPRLTHIRTTPTTTIHRAVAAPMVLG |
| Length | 349 |
| Position | Head |
| Organism | Coleophoma cylindrospora |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Dermateaceae> Coleophoma.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.721 |
| Instability index | 34.21 |
| Isoelectric point | 8.84 |
| Molecular weight | 38248.60 |
| Publications | PubMed=30018880
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22745
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 136.49| 43| 157| 47| 94| 1
---------------------------------------------------------------------------
47- 94 (68.56/55.29) SLGS..DMASDQAQFEDGSHKRKRDLedhgnQEQKKVHVEDSRFGIDDLH
205- 249 (67.94/42.92) SLGKamTMAKGNISRDDWDHKVLGEL.....VVKEKTGAEKARVGVKTAH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.34| 10| 16| 6| 15| 3
---------------------------------------------------------------------------
6- 15 (20.11/10.64) PHTPQSPSNL
24- 33 (18.23/ 9.05) PTSPQTTTSL
---------------------------------------------------------------------------
|