<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22744
| Description |
Uncharacterized protein |
| Sequence | MASLSSPWVEWTGEYTKAAQAEALPPNEWAARVATAAAAAGERGDVQFSAGLAEMLARVLLSGESSGAAPAAAWKYAEAALAARLASPALLLTLLSSRVIPQRVARPTAYRLYLELLRRHGFKLCFQMKAANSNK |
| Length | 135 |
| Position | Tail |
| Organism | Triticum aestivum (Wheat) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | 0.074 |
| Instability index | 31.05 |
| Isoelectric point | 9.72 |
| Molecular weight | 14387.40 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22744
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.18| 15| 16| 7| 21| 1
---------------------------------------------------------------------------
7- 21 (30.00/15.68) PWVEWTGEYTKAAQA
25- 39 (27.19/13.68) PPNEWAARVATAAAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.00| 21| 30| 50| 70| 2
---------------------------------------------------------------------------
50- 70 (35.50/19.34) AGLAEMLAR..VLLSGESSGAAP
79- 101 (28.49/14.31) AALAARLASpaLLLTLLSSRVIP
---------------------------------------------------------------------------
|