<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22717
Description |
Uncharacterized protein |
Sequence | MDANWRPIQGSDPAAGGDPPPPDQAIGAPIWIQPQARTRIVNKISEALKRHLPVSAVSHPDGLNQLQQIAVRFEQRIYDAATTQSDYFRTISLKMLAMETKTQQDPGNDQVIPNQNNSGVNQTSKMQNRYAMAQNAINNGLEQGTSQDIYAPQIQMVGRQQQQQSQQLIYHQHQRPSLQSQQPNITLQPQQQHAQQPAMGLMQPRSQPNQLQESQQHIMSQFQAQPNQLKKQLGMQQQFSMQQRVQTSGGMLLQQNNMDQKNIFIQAQKGLQEASSSTSADFTAQSGHAGAGDWQEDIYQMIQSLKDQYFAQLIELFNKISVKLHHVDSIIPPQKPSEQYDRMKSFKIMLDRILQMLQMSKSTIQPAMRDKIPQYEKQIITILNSQWKPVQPQIQQQLQPPPGK |
Length | 404 |
Position | Tail |
Organism | Triticum aestivum (Wheat) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.829 |
Instability index | 64.86 |
Isoelectric point | 9.32 |
Molecular weight | 45925.39 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22717
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.98| 15| 16| 207| 222| 1
---------------------------------------------------------------------------
207- 222 (26.14/11.20) QPNQLQEsQQHIMSQF
225- 239 (24.84/ 6.79) QPNQLKK.QLGMQQQF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.55| 17| 18| 114| 131| 4
---------------------------------------------------------------------------
114- 131 (26.39/19.19) NQNNSGVNQTSKmQNRYA
135- 151 (30.16/16.95) NAINNGLEQGTS.QDIYA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.39| 21| 379| 1| 24| 6
---------------------------------------------------------------------------
1- 24 (38.49/25.34) MDANWRPIQgsdPAAGGD.PPPPDQ
383- 404 (37.90/17.43) LNSQWKPVQ...PQIQQQlQPPPGK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.76| 18| 30| 316| 333| 10
---------------------------------------------------------------------------
316- 333 (30.99/26.32) LFNKISVKLHHVDSIIPP
349- 366 (30.77/26.07) MLDRILQMLQMSKSTIQP
---------------------------------------------------------------------------
|