<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22716
| Description |
Uncharacterized protein |
| Sequence | MDSDDKKFGKGPRELTGAVDLISQYKLELHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKSASIKPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKDKDKDKDRKKDKHHEKKRKHEGTEDSADVHKHKKSKHKSSKTDEMGNGLS |
| Length | 203 |
| Position | Head |
| Organism | Triticum aestivum (Wheat) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.536 |
| Instability index | 30.40 |
| Isoelectric point | 9.44 |
| Molecular weight | 23439.16 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22716
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.72| 18| 18| 129| 146| 1
---------------------------------------------------------------------------
119- 138 (27.84/ 7.12) KSESKDKEkkH.KKHKDKDKD
159- 177 (26.88/ 6.68) KDRKKDKH..HeKKRKHEGTE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.75| 12| 36| 144| 155| 2
---------------------------------------------------------------------------
144- 155 (23.31/10.85) HKHR...HKDRSKDK
183- 197 (17.44/ 6.28) HKHKkskHKSSKTDE
---------------------------------------------------------------------------
|