Description | Uncharacterized protein |
Sequence | MDIITQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNSYPDPLNPNPNPDGPASQPQTPPAPGAPPPAPLPPQPPQAPPQPALDLAEQPKAMSHALVLAAKKFDALVAALPLSSEEDQLKRIQELQADNEVVGLELQKQLEAAELELQRVEVLFNEATDNCINLKKPD |
Length | 167 |
Position | Middle |
Organism | Triticum aestivum (Wheat) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Triticum. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.462 |
Instability index | 64.47 |
Isoelectric point | 4.36 |
Molecular weight | 18038.27 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP22713 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 42.88| 14| 25| 111| 124| 3 --------------------------------------------------------------------------- 111- 124 (22.06/14.53) LSSEEDQLKRIQEL 139- 152 (20.82/13.37) LEAAELELQRVEVL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) HALVL 2) PQPALDLAEQP | 93 78 | 97 88 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab