<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22713
| Description |
Uncharacterized protein |
| Sequence | MDIITQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNSYPDPLNPNPNPDGPASQPQTPPAPGAPPPAPLPPQPPQAPPQPALDLAEQPKAMSHALVLAAKKFDALVAALPLSSEEDQLKRIQELQADNEVVGLELQKQLEAAELELQRVEVLFNEATDNCINLKKPD |
| Length | 167 |
| Position | Middle |
| Organism | Triticum aestivum (Wheat) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.462 |
| Instability index | 64.47 |
| Isoelectric point | 4.36 |
| Molecular weight | 18038.27 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP22713
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.88| 14| 25| 111| 124| 3
---------------------------------------------------------------------------
111- 124 (22.06/14.53) LSSEEDQLKRIQEL
139- 152 (20.82/13.37) LEAAELELQRVEVL
---------------------------------------------------------------------------
|