<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22705
| Description |
Uncharacterized protein |
| Sequence | MDSDDKKFGKGPRELTGAVDLISQYKLEPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPPHIKPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKDKDKDKDRKKDKHHEKKRKHEGTEDSADVHKHKKSKHKSSKTDEMGNGLS |
| Length | 203 |
| Position | Head |
| Organism | Triticum aestivum (Wheat) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.596 |
| Instability index | 34.09 |
| Isoelectric point | 9.44 |
| Molecular weight | 23509.25 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22705
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 90.62| 18| 18| 129| 146| 1
---------------------------------------------------------------------------
129- 146 (36.39/12.68) H.K.KHKDKDKDREHKKHKH
148- 166 (27.87/ 8.16) H.KdRSKDKDKDKDRKKDKH
167- 185 (26.35/ 7.35) HeK.KRKHEGTEDSADVHKH
---------------------------------------------------------------------------
|