<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22695
| Description |
Uncharacterized protein |
| Sequence | MDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNSYPDPLNPNPNPDGPASQPQPQAPPAPGAPPPAPVPPQPPQAPPQPALDLAEQPKAMSHALVLAAKKFDALVAALPLSSEEDQLKRIQELQAENEVVGLELQKQLEAAELELERVEVLFNEATDNCINLKKPD |
| Length | 169 |
| Position | Middle |
| Organism | Triticum aestivum (Wheat) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.470 |
| Instability index | 68.54 |
| Isoelectric point | 4.35 |
| Molecular weight | 18220.45 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP22695
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.22| 9| 17| 54| 63| 1
---------------------------------------------------------------------------
54- 63 (17.18/ 7.54) QPqPQAPPAP
74- 82 (22.04/ 6.50) QP.PQAPPQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 30.52| 8| 26| 39| 48| 2
---------------------------------------------------------------------------
39- 48 (11.05/ 8.88) PDPlNPNPnP
66- 73 (19.47/ 6.25) PPP.APVP.P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.60| 14| 25| 113| 126| 4
---------------------------------------------------------------------------
113- 126 (22.04/15.63) LSSEEDQLKRIQEL
141- 154 (20.55/14.14) LEAAELELERVEVL
---------------------------------------------------------------------------
|