<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22695

Description Uncharacterized protein
SequenceMDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNSYPDPLNPNPNPDGPASQPQPQAPPAPGAPPPAPVPPQPPQAPPQPALDLAEQPKAMSHALVLAAKKFDALVAALPLSSEEDQLKRIQELQAENEVVGLELQKQLEAAELELERVEVLFNEATDNCINLKKPD
Length169
PositionMiddle
OrganismTriticum aestivum (Wheat)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
Aromaticity0.02
Grand average of hydropathy-0.470
Instability index68.54
Isoelectric point4.35
Molecular weight18220.45
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU366036

GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
transcription coregulator activity	GO:0003712	IBA:GO_Central

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22695
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.22|       9|      17|      54|      63|       1
---------------------------------------------------------------------------
   54-   63 (17.18/ 7.54)	QPqPQAPPAP
   74-   82 (22.04/ 6.50)	QP.PQAPPQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      30.52|       8|      26|      39|      48|       2
---------------------------------------------------------------------------
   39-   48 (11.05/ 8.88)	PDPlNPNPnP
   66-   73 (19.47/ 6.25)	PPP.APVP.P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.60|      14|      25|     113|     126|       4
---------------------------------------------------------------------------
  113-  126 (22.04/15.63)	LSSEEDQLKRIQEL
  141-  154 (20.55/14.14)	LEAAELELERVEVL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22695 with Med21 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNSYPDPLNPNPNPDGPASQPQPQAPPAPGAPPPAPVPPQPPQAPPQPALDLAEQPKA
1
92










Molecular Recognition Features






MoRF SequenceStartStop




1) HALVL
2) PQPALDLAEQPK
95
80
99
91