Description | Uncharacterized protein |
Sequence | MDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNSYPDPLNPNPNPDGPASQPQPQAPPAPGAPPPAPVPPQPPQAPPQPALDLAEQPKAMSHALVLAAKKFDALVAALPLSSEEDQLKRIQELQAENEVVGLELQKQLEAAELELERVEVLFNEATDNCINLKKPD |
Length | 169 |
Position | Middle |
Organism | Triticum aestivum (Wheat) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Triticum. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.470 |
Instability index | 68.54 |
Isoelectric point | 4.35 |
Molecular weight | 18220.45 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP22695 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 39.22| 9| 17| 54| 63| 1 --------------------------------------------------------------------------- 54- 63 (17.18/ 7.54) QPqPQAPPAP 74- 82 (22.04/ 6.50) QP.PQAPPQP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 30.52| 8| 26| 39| 48| 2 --------------------------------------------------------------------------- 39- 48 (11.05/ 8.88) PDPlNPNPnP 66- 73 (19.47/ 6.25) PPP.APVP.P --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 42.60| 14| 25| 113| 126| 4 --------------------------------------------------------------------------- 113- 126 (22.04/15.63) LSSEEDQLKRIQEL 141- 154 (20.55/14.14) LEAAELELERVEVL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) HALVL 2) PQPALDLAEQPK | 95 80 | 99 91 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab