<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22672

Description Uncharacterized protein
SequenceMASNMQTPGPPQPPRPPMMGSTAPQNMGQPMPMQWPPGPPQQPPQFMQPAPQQYRPIGQAMPGVNMGMPGQMQHFQQPGPHMPHSGHVPPASQAVPMPYQAARPMSSAPMQPQQQAVFPGGLMPTMGAPMPPPSYTYQPTSVPPGSQPWGTAPGQGAPLVSPMVQPGHQSLSASVPPVSSTEPSSADWQEHSSGDGKKYYYNKRTKQSSWEKPAELMTPLERADASTEWKEFTTAEGRKYYYNKVTKQSKWSIPDELRIARELAEKTSNQQPAREIESTTVAPVGSTSVSVETSLPATQSSSLVGTIAPSSHDAIANLPPPGAGPSYNGDISSSSSMQNGGTSAVVAPVTTSTGDPSVASDAGTNRSTYGSSSVPSTTDTKVGASAEDLEEAKKTMPTAGKINVTPLEDKTSEEEPVVYATKLEAKNAFKSLLESANVQSDWSWDQAMRVIISDKRYGALKTLGERKQAFNEYLNQRKKIEVEERRVKQRKARDDFFTMLEECKDLTSSLRWSKAITMFGHDERFNAVERPKEREDLFENYLVELQKKEKAKAAEEHKRRIAEYREFLESCDFIKANTQWRKVQDRLEDDERYARLEKIDRLDVFQDYIRHLEKEEEEQKRIRKEQLRRQERKNRDEFRKMMEEHVADGTLNAKTYWRDYCSQIKDSRAYLAVASNLSGSMPKELFDDVMEELDKQYQDDRALIKDEVKSGKIPMLASWTLEDFQAAVTEDEKYKGVSNINIKLIYEDQIERLKEKDLKEAKKRQRLGDNFLDLLYSIKEITAASTWDDSKSLFDDTQEYRDLGGETYAKELFEEYIARLKERLKEKERMREEEKAKKEKDREEREKKKEKEKEKKEKDRKEKERDREKEREKEKGKDRSRRDEMDIDDDVEIHASKDKKREKDKEKKHKRRHHDTTDSERDEKDESRKSRRHSSDRKKSRKHTHASDSDSENRHRRHKKDRDSSRKNGGHEELEDGELGEDGEIH
Length986
PositionUnknown
OrganismTriticum aestivum (Wheat)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
Aromaticity0.06
Grand average of hydropathy-1.213
Instability index55.71
Isoelectric point6.50
Molecular weight112825.51
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
GO - Biological Process
mRNA cis splicing, via spliceosome	GO:0045292	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP22672
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.98|      17|      19|     837|     855|       1
---------------------------------------------------------------------------
  845-  862 (24.78/ 8.46)	REKKKEKEKE.kKEKDRKE
  863-  881 (23.20/ 8.61)	KERDREKEREkeKGKDRSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     175.96|      27|      27|       6|      32|       2
---------------------------------------------------------------------------
    6-   32 (63.92/28.55)	Q.TPGP....PQP.PRPPMMGSTAPQN...MGQPMP
   34-   62 (43.52/17.41)	QwPPGP....PQQ.P.PQFM.QPAPQQyrpIGQAMP
   67-   97 (34.36/12.40)	G.MPGQmqhfQQPgPHMPHSGHVPPAS...QAVPM.
  152-  176 (34.16/12.29)	..APGQ....GAP.LVSPMV.QPGHQS...LSASVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     147.31|      38|      38|     187|     224|       3
---------------------------------------------------------------------------
  187-  224 (75.19/56.29)	DWQEHSSGDGKKYYYNKRTKQSSWEKPAELMTPLERAD
  228-  265 (72.11/53.61)	EWKEFTTAEGRKYYYNKVTKQSKWSIPDELRIARELAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     390.60|      60|      60|     550|     609|       4
---------------------------------------------------------------------------
  425-  474 (62.25/34.59)	.AKNA.......................FK...SL...LES..AN..VQSDWSWDQAMRVIISDKRYGA.................L..KT.LgERKQAFNEYL
  476-  542 (70.30/40.01)	QRKKIEVEER.RV.............KQRKardDFftmLEE..CK.DLTSSLRWSKAITMFGHDERFNA.................V..ERpK.EREDLFENYL
  550-  609 (94.70/56.45)	KAKAAEEHKR.RI.............AEYR...EF...LES..CD.FIKANTQWRKVQDRLEDDERYAR.................L..EK.I.DRLDVFQDYI
  611-  700 (53.74/28.86)	HLEKEEEEQK.RIrkeqlrrqerknrDEFR...KM...MEEhvADgTLNAKTYWRDYCSQIKDSRAYLAvasnlsgsmpkelfddvM..EE.L.DKQ..YQD.D
  701-  750 (50.83/26.90)	RALIKDEVKSgKI.............PMLA...SW..tLE....D.F..........QAAVTEDEKYKG.................V..SN.I.NIKLIYEDQI
  765-  817 (58.79/32.26)	........QR.LG.............DNFL...DL...LYS..IK.EITAASTWDDSKSLFDDTQEYRD.................LggET.Y.AK.ELFEEYI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      72.24|      16|      69|     827|     842|       5
---------------------------------------------------------------------------
  827-  842 (24.31/ 9.24)	KERMREEEKAKKEKDR
  897-  912 (24.45/ 9.34)	KDKKREKDKEKKHKRR
  947-  962 (23.49/ 8.70)	SDSDSENRHRRHKKDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      52.81|      16|      24|     296|     311|       6
---------------------------------------------------------------------------
  286-  309 (19.01/ 9.10)	STsvsvetslPATQSSSLVGTIAP
  310-  333 (18.17/ 8.33)	SShdaianlpPPGAGPSYNGDISS
  334-  351 (15.63/ 6.00)	SS......smQNGGTSAVVAPVTT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.20|      17|      23|     104|     120|       7
---------------------------------------------------------------------------
  104-  120 (35.62/19.61)	PMSSAPMQP.....QQQAVFPG
  124-  145 (31.58/16.53)	PTMGAPMPPpsytyQPTSVPPG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP22672 with Med35 domain of Kingdom Viridiplantae

Unable to open file!