<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22649
Description |
Uncharacterized protein |
Sequence | MAANFWTSSHSKQLLDPEDVDVVPAQDRERGVTPVEFRLVKIHMSFHIWRLAQQVKVRQRVIATAITYFRRVYTRKSMTEYDPRLVAPACLYLASKVEESTVQARLLVFYIKKMCGSDDKYRFEIKDILEMEMKLLEALDYYLVVYHPYRPLLQLLQDAGITDLTQFAWGLVNDTYKMDLILIYPPYMIALACIYIASVLKDKDTTSWFEELRVDMNIVKNISMEILDFYDTYKIDPQRGLQEDKIIPVMNKLPSKA |
Length | 257 |
Position | Kinase |
Organism | Triticum aestivum (Wheat) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.099 |
Instability index | 48.21 |
Isoelectric point | 6.45 |
Molecular weight | 30156.90 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP22649
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 73.28| 15| 101| 81| 95| 1
---------------------------------------------------------------------------
60- 71 (14.31/ 6.04) ...RVIATAITYFRR
81- 95 (28.94/18.83) YDPRLVAPACLYLAS
184- 198 (30.02/19.78) YPPYMIALACIYIAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 113.84| 37| 85| 118| 161| 2
---------------------------------------------------------------------------
118- 161 (56.42/46.88) DDKYRFEikdILEMEMKL.....LEALDYylvvYHPYR..PLLQLLQDAGI
204- 247 (57.42/32.17) DTTSWFE...ELRVDMNIvknisMEILDF....YDTYKidPQRGLQEDKII
---------------------------------------------------------------------------
|