<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22641

Description Uncharacterized protein
SequenceMDRLRGSALLLGVLLAGSLFALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYIQVKIKDGETKVFSPEEISAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKRGGEKNILVFDLGGGTFDVSILTIDNGVFEVLATNGDTHLGGEDFDHRIMDYFIKLIKKKHGKDISKDNRALGKLRREAERAKRALSNQHQVRVEIESLFDGTDFSEPLTRARFEELNNDLFRKTMGPVKKAMDDAGLEKTQIHEIVLVGGSTRIPKVQQLLRDYFDGKEPNKGVNPDEAVAFGAAVQGSILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTAEKEDYEEKLKEVEAVCNPIVSAVYQRSGGAPGGEGADGGVDDEDHDEL
Length665
PositionUnknown
OrganismTriticum aestivum (Wheat)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
Aromaticity0.06
Grand average of hydropathy-0.473
Instability index25.37
Isoelectric point5.11
Molecular weight73199.04
Publications

Function

Annotated function
GO - Cellular Component
endoplasmic reticulum	GO:0005783	IEA:UniProtKB-KW
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP22641
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      65.80|      14|      15|      98|     111|       1
---------------------------------------------------------------------------
   75-   88 (20.50/ 9.62)	DGERLIGEAAKNQA
   98-  111 (23.65/12.07)	DVKRLIGRKFEDKE
  115-  127 (21.65/10.51)	DMK.LVPYKIVNKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.32|      13|      15|     183|     197|       2
---------------------------------------------------------------------------
  183-  195 (20.08/ 6.46)	AQRQATKDAGVIA
  200-  212 (19.23/ 9.51)	ARIINEPTAAAIA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.65|      20|      21|     586|     606|       3
---------------------------------------------------------------------------
  586-  606 (27.81/17.40)	DKLaDKLESEEKEKVEEALKE
  609-  628 (35.84/18.90)	EWL.DENQTAEKEDYEEKLKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     244.22|      76|     104|     340|     416|       4
---------------------------------------------------------------------------
  340-  416 (123.79/91.40)	RKTMGPVKKAMDDAGLEKTQIH.EIVLVGGSTRIPKVQQLLRDY.FDGKEPNKGVNPDEAVAFGAAVQGsILSGEGGDE
  445-  522 (120.43/84.18)	RNTVIPTKKSQVFTTYQDQQTTvSIQVFEGERSMTKDCRLLGKFdLSGIPPAPRGTPQIEVTFEVDANG.ILNVKAEDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.25|      14|      21|      35|      48|       6
---------------------------------------------------------------------------
   35-   48 (26.36/17.04)	VIGIDLGT..TYSCVG
   57-   72 (20.90/12.06)	IIANDQGNriTPSWVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.02|      11|      25|     229|     239|       7
---------------------------------------------------------------------------
  229-  239 (20.52/11.23)	LGGGTFDVSIL
  257-  267 (22.49/12.98)	LGGEDFDHRIM
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP22641 with Med37 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) KDKLADKLESEEKEKVEEALKEALEWLDENQTAEKEDYEEKLKE
585
628

Molecular Recognition Features

MoRF SequenceStartStop
NANANA