<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22638

Description Uncharacterized protein
SequenceMDANWRPTQGSDPAALGDWRAQLQPEARSRVVNKILETLRKVLPVSVPDELNELQEVARQFEDKIYTEATNQSDYVRKISLKMVSMETNRQQAHGNAQVIPNQNNSAPALPPQGRNQAQTTKRQSSQQPMMQMLSGLHPGQSTIPQTQPMAMQSATQSGTQQNQLNFVQQSVQSLLHQPQQTVGRQQQQAHPSIHQQPSLHSQQPNIPLQQQQQQLMGHQPNLQQDQLIGQHNGAVEMQEQQRLPVQSNILLNVQQTQQMLNQPYMLLHQTHQLGSQANMASLQHQQLLGTVPYMLLQQNNMDPIQAQRGLQEVSSSSHEDADADYWQEEIYQMVKMLKDQYFADLSELFNKICVKLQHVESIIPPPIPSEQYDRMKSFKTLLERILQMLQISKSIIQPAMRDRVPQYEKQIITILNCLRKAVQPQVQQ
Length429
PositionTail
OrganismTriticum aestivum (Wheat)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
Aromaticity0.04
Grand average of hydropathy-0.755
Instability index66.09
Isoelectric point6.90
Molecular weight49053.01
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
chromatin DNA binding	GO:0031490	IBA:GO_Central
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22638
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     152.16|      26|      26|     197|     222|       1
---------------------------------------------------------------------------
  134-  171 (31.06/ 9.32)	LSGLHPGQSTIPQTQpmamqsatqsgtQQNQLNFVQQS
  173-  193 (33.31/10.59)	QSLLHQPQQTVGRQQ............QQ....AH.PS
  197-  222 (52.19/21.18)	QPSLHSQQPNIPLQQ............QQQQLMGHQPN
  271-  294 (35.60/11.87)	THQLGSQANMASL..............QHQQLLGTVPY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      98.73|      25|      28|     374|     399|       2
---------------------------------------------------------------------------
  349-  366 (24.19/13.20)	........LFNKICVKLQHVESIIPP
  374-  399 (37.12/29.57)	DRMKSFKtLLERILQMLQISKSIIQP
  403-  425 (37.42/24.69)	DRVPQYE...KQIITILNCLRKAVQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.74|      16|      28|      13|      28|       3
---------------------------------------------------------------------------
   13-   28 (29.54/17.14)	PAALGDWRAQLQPEAR
   44-   59 (27.20/15.26)	PVSVPDELNELQEVAR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.88|      17|      19|      92|     108|       5
---------------------------------------------------------------------------
   92-  108 (30.25/15.81)	QAHGNAQVIPNQNNSAP
  113-  129 (29.63/15.33)	QGRNQAQTTKRQSSQQP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22638 with Med15 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) RKISLKMVSMETNRQQAHGNAQVIPNQNNSAPALPPQGRNQAQTTKRQSSQQPMMQMLSGLHPGQSTIPQTQPMAMQSATQSGTQQNQLNFVQQSVQSLLHQPQQTVGRQQQQAHPSIHQQPSLHSQQPNIPLQQQQQQLMGHQPNLQQDQLIGQHNGAVEMQEQQ
77
242










Molecular Recognition Features






MoRF SequenceStartStop




1) MDANWR
1
6