<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22608
Description |
Uncharacterized protein |
Sequence | MSGSNQMASDGKFGKGPRELTGAVDLISRYRLLNHHSFFCKKPLPLAISDTHYLQNVVGDTEIRKGEGMEIDQLIQSPDLREKKTAYIKPFDMETLGHAFQLRETAPVDLPSAEKGTPTISGNSKVKSRDKVKKHKKHKAKDKDKEQKKHKHRHKDRSKDKDKDKEKEKEKEKEKEKEKEKEKEKEKDKDKEKKKEKSVHHDLGGDNSKKHHEKKRKHEGMENLAAGRNHKKTQKRKVQ |
Length | 239 |
Position | Head |
Organism | Triticum aestivum (Wheat) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -1.661 |
Instability index | 28.23 |
Isoelectric point | 9.74 |
Molecular weight | 27735.26 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP22608
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 76.15| 15| 15| 163| 177| 1
---------------------------------------------------------------------------
141- 155 (26.34/ 7.32) KDKDKEQKKHKHRHK
163- 177 (25.30/ 6.78) KDKEKEKEKEKEKEK
179- 193 (24.52/ 6.37) KEKEKEKEKDKDKEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.35| 14| 19| 74| 92| 3
---------------------------------------------------------------------------
74- 92 (16.75/23.01) LIQSPDLREkkTAyikPFD
96- 109 (26.60/15.60) LGHAFQLRE..TA...PVD
---------------------------------------------------------------------------
|