<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22585
| Description |
Uncharacterized protein |
| Sequence | MCICFLKSNLRWTCILQMSGSNQMASDGKFGKGPRELTGAVDLISRYRLLNHHSFFCKKPLPLAISDTHYLQNVVGDTEIRKGEGMEIDQLIQNPDLREKKTAYIQPFDMETLGHAFQLRETAPVDLPSAEKGTPTISGKSKVKSRDKVKKHKKHKEKDKDKEHKKHKHRHKDRSKDKDKDKEKEKEKEKEKEKEKDKDKDKEKKKEKSVHHDLGGDNSKKHHEKKRKHDGMENLAAVRNHKKTQKRKIQ |
| Length | 250 |
| Position | Head |
| Organism | Triticum aestivum (Wheat) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.451 |
| Instability index | 28.94 |
| Isoelectric point | 9.71 |
| Molecular weight | 29154.12 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP22585
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 113.44| 17| 17| 172| 188| 1
---------------------------------------------------------------------------
153- 168 (29.33/ 9.20) K.KHKEKDKDKEHKKHK
172- 188 (29.74/ 9.41) KDRSKDKDKDKEKEKEK
192- 208 (29.25/ 9.16) KEKEKDKDKDKEKKKEK
212- 227 (25.12/ 6.99) HDLGGDNSK.KHHEKKR
---------------------------------------------------------------------------
|