<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22561
Description |
Uncharacterized protein |
Sequence | MDSDDKKFGKGPRELTGAVDLISQYKLQPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMKLDQLVQNAYLRDKPAYIKSFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKDKDKDKDKKKDKHHEKKRKHEGTEDSADVHKHKKSKHKSSKTDEMGNGLS |
Length | 203 |
Position | Head |
Organism | Triticum aestivum (Wheat) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.565 |
Instability index | 32.49 |
Isoelectric point | 9.56 |
Molecular weight | 23469.27 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP22561
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.71| 11| 31| 117| 127| 2
---------------------------------------------------------------------------
117- 127 (18.31/ 6.05) KPKSESKDKEK
147- 157 (19.39/ 6.82) RHKDRSKDKDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.75| 15| 17| 164| 178| 3
---------------------------------------------------------------------------
164- 178 (28.23/12.09) DKHHEKKRKHEG..TED
181- 197 (22.52/ 8.23) DVHKHKKSKHKSskTDE
---------------------------------------------------------------------------
|