<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22548

Description ATP-dependent DNA helicase
SequenceMEEEEIIEEELLLVESQLNGLQDKIKTLLDQQEELYERQAQLKALLEISKTSRDTSNSAPSVPLEDWSGKFSWDSQVDDTRFNVFGISSYRSNQREIINSIMSGKDVLVIMAAGGGKSLCYQLPAVLRDGITLVVSPLLSLIQDQVMGLAALGIPAHMLTSTTNKEIEKFIYKALEKGEGELKILYVTPEKISKSKRFMSKLEKCHHAGRLSLVAIDEAHCCSQWGHDFRPDYKNLGILKIQFPSVPMIALTATATSKVQMDLIEMLHIPRSVKFVSTVNRPNLFYRVYEKSSVGKVVIDEIANFISESYPNNESGIVYCFSRKECEQVAKELRGRGISADYYHADMDVVAREKVHMRWSKSKSQVIXXXXAFGMGINKPDVRFVVHHSLSKSMETYYQESGRAGRDGLPSECVLYYRPGDVPRQSSMVFYENCGLQNLYDIARYCQSKKNCRRGAFFQHFGEAVQECNGMCDNCVSSIELKDIDATYHTKIIVSLLQEMQQNDQRATLLQLVDKFKTKWKHSGCSNEAVDLKKEEIEQLIVQLILDRVLKEEFQHTAYTTNAYVVLGPLWKPALQGNRPVKLTSASHSQDSGDRFKSAKRNQMSNLEAKLDDMRRTISSRNGGIFPHAVLSTEQISLLNCHTPTTIAELEKLIGKVKTDKYGSDIIEVMRSETGSGKDSGDGAKRQKKDKGVVFVESSEEG
Length702
PositionUnknown
OrganismTriticum aestivum (Wheat)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
Aromaticity0.07
Grand average of hydropathy-0.393
Instability index43.22
Isoelectric point6.80
Molecular weight78647.94
Publications









Function






Annotated function


GO - Cellular Component
chromosome	GO:0005694	IBA:GO_Central
cytoplasm	GO:0005737	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
3'-5' DNA helicase activity	GO:0043138	IBA:GO_Central
ATP binding	GO:0005524	IEA:UniProtKB-KW
four-way junction helicase activity	GO:0009378	IBA:GO_Central
nucleic acid binding	GO:0003676	IEA:InterPro

GO - Biological Process
DNA duplex unwinding	GO:0032508	IBA:GO_Central
DNA recombination	GO:0006310	IBA:GO_Central
DNA repair	GO:0006281	IBA:GO_Central
DNA unwinding involved in DNA replication	GO:0006268	IBA:GO_Central
double-strand break repair via homologous recombination	GO:0000724	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22548
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     136.65|      46|      85|     556|     603|       1
---------------------------------------------------------------------------
  556-  603 (71.36/63.21)	HTAyTTNAYV..VLGPLwKPALQGNRPVK.LTSASHS.QDSGDRFKSAKRNQ
  642-  691 (65.29/45.80)	HTP.TTIAELekLIGKV.KTDKYGSDIIEvMRSETGSgKDSGDGAKRQKKDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.39|      23|      26|       8|      30|       2
---------------------------------------------------------------------------
    8-   30 (36.33/24.49)	EEELLLVESQLNGLQDKIKTLLD
   32-   54 (37.06/25.13)	QEELYERQAQLKALLEISKTSRD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.26|      14|      26|     168|     182|       3
---------------------------------------------------------------------------
  168-  182 (20.55/16.83)	EKFIYKaLEK..GEGEL
  196-  211 (20.71/11.76)	KRFMSK.LEKchHAGRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.49|      13|      30|     348|     362|       4
---------------------------------------------------------------------------
  348-  362 (21.25/20.87)	DVvaREKVHMRWSKS
  381-  393 (24.24/16.24)	DV..RFVVHHSLSKS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.73|      19|      30|     430|     448|       5
---------------------------------------------------------------------------
  430-  448 (36.63/24.74)	FYENCG..LQNLYDIARYCQS
  457-  477 (34.11/22.54)	FFQHFGeaVQECNGMCDNCVS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.44|      26|      30|     282|     310|       6
---------------------------------------------------------------------------
  284-  310 (36.93/28.48)	LFYrVYEKSSVGKVVIDEIANFISESY
  317-  342 (43.52/21.52)	IVY.CFSRKECEQVAKELRGRGISADY
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22548 with Med34 domain of Kingdom Viridiplantae
Unable to open file!