<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22533

Description ATP-dependent DNA helicase
SequenceMEDEENIEEELLLVESQLNGLQDKIKTLLDQQEELYERQAQLKAMLEISKTSRDASNSAPSVALEDWSGKFSWDSQADDTRFNVFGISSYRSNQREIINSIMSGKDVLVIMAAGGGKSLCYQLPAVLRDGITLVVSPLLSLIQDQVMGLAALGIPAHMLTSTTNKEIEKFIYKALEKGEGELKILYVTPEKISKSKRFMSKLEKCHHAGRLSLVAIDEAHCCSQWGHDFRPDYKNLGILKIQFPSVPMIALTATATSKVQMDLIEMLHIPRSVKFVYEKSSVGKVVIDEIANFISESYPNNESGIVYCFSRKECEQVAKELRGRGISADYYHADMDVVAREKVHMRWSKSKSQVIVGTVAFGMGINKPDVRFVVHHSLSKSMETYYQESGRAGRDGLPSECVLYYRPGDVPRQSSMVFYENCGLQNLYDIARYCQSKKNCRRGAFFQHFGEAVQECNGMCDNCVSSIELKDIDATYHTKITVSLLQEMQQNDQRATLLQLVDKFKTKWKHSGCSNEAVDLKKEEIEQLIVQLILDRVLKEEFQHTAYTTNAYVVLGPLWKPALQGNRPVKLTSAIHSQDSGDRFKSAKRNQMSNLEAKLDDLRRTISSRNGGIFPHAVLSTEQISLLNCHTPTTIAELEKLIGKVKTDKYGSDIIEVMWSETGSGKDSGDGAKRQKKDKGVVFVESGEEEG
Length691
PositionUnknown
OrganismTriticum aestivum (Wheat)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
Aromaticity0.07
Grand average of hydropathy-0.384
Instability index42.49
Isoelectric point6.32
Molecular weight77602.66
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
DNA helicase activity	GO:0003678	IEA:UniProtKB-EC
hydrolase activity	GO:0016787	IEA:UniProtKB-KW
nucleic acid binding	GO:0003676	IEA:InterPro

GO - Biological Process
DNA recombination	GO:0006310	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22533
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.49|      13|      30|     336|     350|       1
---------------------------------------------------------------------------
  336-  350 (21.25/20.74)	DVvaREKVHMRWSKS
  369-  381 (24.24/16.13)	DV..RFVVHHSLSKS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.94|      14|      26|     168|     182|       2
---------------------------------------------------------------------------
  168-  182 (20.61/16.26)	EKFIYKaLEKGE..GEL
  196-  211 (22.33/12.62)	KRFMSK.LEKCHhaGRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      93.26|      31|      31|     487|     517|       3
---------------------------------------------------------------------------
  487-  517 (53.16/40.78)	EMQQNDQRATLLQLV.DK.FKTKWKHSGCSNEA
  519-  551 (40.09/28.84)	DLKKEEIEQLIVQLIlDRvLKEEFQHTAYTTNA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.54|      12|     124|     307|     318|       4
---------------------------------------------------------------------------
  307-  318 (24.54/13.91)	YCFSRKECEQVA
  433-  444 (25.01/14.30)	YCQSKKNCRRGA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.23|      23|      23|       8|      30|       5
---------------------------------------------------------------------------
    8-   30 (35.83/27.09)	EEELLLVESQLNGLQDKIKTLLD
   32-   54 (37.40/28.60)	QEELYERQAQLKAMLEISKTSRD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.87|      14|      85|     578|     591|       6
---------------------------------------------------------------------------
  578-  591 (25.25/12.69)	QDSGDRFKSAKRNQ
  666-  679 (24.62/12.23)	KDSGDGAKRQKKDK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22533 with Med34 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




1) IIEVMWSETGSGKDSGDGAKRQKKDKGVVFVESGEEEG
654
691