<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22530

Description ATP-dependent DNA helicase
SequenceMEDEENIEEELLLVESQLNGLQDKIKTLLDQQEELYERQAQLKAMLEISKTSRDASNSAPSVALEDWSGKFSWDSQADDTRFNVFGISSYRSNQREIINSIMSGKDVLVIMAAGGGKSLCYQLPAVLRDGITLVVSPLLSLIQDQVMGLAALGIPAHMLTSTTNKEIEKFIYKALEKGEGELKILYVTPEKISKSKRFMSKLEKCHHAGRLSLVAIDEAHCCSQWGHDFRPDYKNLGILKIQFPSVPMIALTATATSKVQMDLIEMLHIPRSVKFVSTVNRPNLFYRVYEKSSVGKVVIDEIANFISESYPNNESGIVYCFSRKECEQVAKELRGRGISADYYHADMDVVAREKVHMRWSKSKSQVIVGTVAFGMGINKPDVRFVVHHSLSKSMETYYQESGRAGRDGLPSECVLYYRPGDVPRQSSMVFYENCGLQNLYDIARYCQSKKNCRRGAFFQHFGEAVQECNGMCDNCVSSIELKDIDATYHTKITVSLLQEMQQNDQRATLLQLVDKFKTKWKHSAGCSNEAVDLKKEEIEQLIVQLILDRVLKEEFQHTAYTTNAYVVLGPLWKPALQGNRPVKLTSAIHSQDSGDRFKSAKRNQMSNLEAKLDDLRRTISSRNGGIFPHAVLSTEQISLLNCHTPTTIAELEKLIGKVKTDKYGSDIIEVMWSETGSGKDSGDGAKRQKKDKGVVFVESGEEEG
Length704
PositionUnknown
OrganismTriticum aestivum (Wheat)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
Aromaticity0.07
Grand average of hydropathy-0.382
Instability index42.39
Isoelectric point6.53
Molecular weight79121.38
Publications









Function






Annotated function


GO - Cellular Component
chromosome	GO:0005694	IBA:GO_Central
cytoplasm	GO:0005737	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
3'-5' DNA helicase activity	GO:0043138	IBA:GO_Central
ATP binding	GO:0005524	IEA:UniProtKB-KW
four-way junction helicase activity	GO:0009378	IBA:GO_Central
nucleic acid binding	GO:0003676	IEA:InterPro

GO - Biological Process
DNA duplex unwinding	GO:0032508	IBA:GO_Central
DNA recombination	GO:0006310	IBA:GO_Central
DNA repair	GO:0006281	IBA:GO_Central
DNA unwinding involved in DNA replication	GO:0006268	IBA:GO_Central
double-strand break repair via homologous recombination	GO:0000724	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22530
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     138.36|      46|      85|     557|     604|       1
---------------------------------------------------------------------------
  557-  604 (71.34/54.82)	HTAyTTNAYV..VLGPLwKPALQGNRPVK.LTSAIHS.QDSGDRFKSAKRNQ
  643-  692 (67.02/40.94)	HTP.TTIAELekLIGKV.KTDKYGSDIIEvMWSETGSgKDSGDGAKRQKKDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.49|      13|      30|     348|     362|       2
---------------------------------------------------------------------------
  348-  362 (21.25/20.79)	DVvaREKVHMRWSKS
  381-  393 (24.24/16.19)	DV..RFVVHHSLSKS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.26|      14|      30|     168|     182|       3
---------------------------------------------------------------------------
  168-  182 (20.55/14.15)	EKFIYKaLEK..GEGEL
  196-  211 (20.71/ 9.85)	KRFMSK.LEKchHAGRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.73|      19|      30|     430|     448|       4
---------------------------------------------------------------------------
  430-  448 (36.63/26.69)	FYENCG..LQNLYDIARYCQS
  457-  477 (34.11/24.33)	FFQHFGeaVQECNGMCDNCVS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22530 with Med34 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




1) IIEVMWSETGSGKDSGDGAKRQKKDKGVVFVESGEEEG
667
704