<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22519
| Description |
Uncharacterized protein |
| Sequence | MDHHHPPPLPQQHGDHYRPLVLSPQPDHAHALQYQQPQQQATPPPQHHHPSLASHFHLLHLVTRLGDAIATGTRDQAFDALVEELTSQFARSQQLLNSISGTLSSKSVTVEGQMQSLEETRQLLDQRKDLIAKYKSSVEDLLKGDPTR |
| Length | 148 |
| Position | Middle |
| Organism | Triticum aestivum (Wheat) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.770 |
| Instability index | 50.92 |
| Isoelectric point | 6.33 |
| Molecular weight | 16629.34 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22519
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.47| 14| 43| 2| 16| 1
---------------------------------------------------------------------------
3- 16 (32.83/15.02) HHHPPPLPQQHGDH
47- 60 (26.64/ 7.12) HHHPSLASHFHLLH
---------------------------------------------------------------------------
|