<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22505
Description |
Uncharacterized protein |
Sequence | MDHHHPPPLPQQHGDHYRPLVLSPQPDHAHALQYQQPQQQQATPPPQHHHPSLASHFHLLHLVTRLGDAIATGARDQAFDALVEELTSQFARSQQLLNSISGTLSSKSVVLLGCER |
Length | 116 |
Position | Middle |
Organism | Triticum aestivum (Wheat) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.597 |
Instability index | 55.14 |
Isoelectric point | 6.47 |
Molecular weight | 12896.24 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22505
No repeats found
|