<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22435

Description Uncharacterized protein
SequenceMFVMTIDSLEHVKNFFIVTAVHPPTNGRYLRLSEPEFQRISRSPPISPSPMAEPPPPPSQSPAQTPPPTQQQTPAATARDEMMACVAALEAALLPCLPARELQAVDRSLQSSHQIDVERHARDFMEAAKKLQSYFITMQREDQPTDEELLRKEITTMEEELKTKSELIAKHKSLIEGWQKELKVQLGKHNTELERV
Length196
PositionHead
OrganismTriticum aestivum (Wheat)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
Aromaticity0.05
Grand average of hydropathy-0.593
Instability index71.63
Isoelectric point5.73
Molecular weight22232.20
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP22435
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.09|      16|      17|      41|      56|       1
---------------------------------------------------------------------------
   41-   56 (31.93/12.18)	SRSPPISPSPMAEPPP
   59-   74 (29.16/10.63)	SQSPAQTPPPTQQQTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.64|      17|      17|     136|     152|       2
---------------------------------------------------------------------------
  136-  152 (29.61/17.45)	ITMQREDQPTDEELLRK
  154-  170 (27.03/15.42)	ITTMEEELKTKSELIAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      53.42|      12|      19|      99|     110|       3
---------------------------------------------------------------------------
   78-   90 (15.82/ 8.06)	ARdEMMACVAALE
   99-  110 (18.62/10.47)	AR.ELQAVDRSLQ
  121-  132 (18.98/10.78)	AR.DFMEAAKKLQ
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP22435 with Med28 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) RYLRLSEPEFQRISRSPPISPSPMAEPPPPPSQSPAQTPPPTQQQTPAATARDE
28
81

Molecular Recognition Features

MoRF SequenceStartStop
NANANA