<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22434
| Description |
Uncharacterized protein |
| Sequence | MMRKKRSGGGMDATVDELSAAYKEFVAAAVAVMEAREQSGGQKTAATDAALEAFKQRWELFRVSCDHAEELVESIRQRIGSECLVDEATGSSSSASAPASVALAAPGIKPISAVRLEQMSKAVRWLVIELQHGAGGPSAAGPGGGVSTPAAGAGGQHVHGGVESRFPEDGTQ |
| Length | 172 |
| Position | Tail |
| Organism | Triticum aestivum (Wheat) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.196 |
| Instability index | 58.80 |
| Isoelectric point | 5.59 |
| Molecular weight | 17662.58 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22434
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.57| 17| 19| 17| 35| 1
---------------------------------------------------------------------------
11- 32 (17.28/17.78) MDAtvdELSAAYKefVAAAVAV
33- 50 (25.29/17.04) MEA..rEQSGGQK..TAATDAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.33| 18| 44| 90| 107| 2
---------------------------------------------------------------------------
90- 107 (29.82/14.47) GSSSSASAPASVALAAPG
135- 152 (33.50/17.13) GGPSAAGPGGGVSTPAAG
---------------------------------------------------------------------------
|