<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22404
| Description |
Uncharacterized protein |
| Sequence | MMRKKLSGGGMDATVDELSAAYKEFVAAAVAVMEAREQSGGQKMAATDAALEAFKQRWELFRVSCDHAEELVESIRQRIGSECLVDEATGSSSSASTPASVALAAPGIKPISAVRLEQMSKAVRWLVIELQHGVGGPSAAGPGGGVSTPAAGAGGQHVHGGVESRFPEDGTQ |
| Length | 172 |
| Position | Tail |
| Organism | Triticum aestivum (Wheat) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.133 |
| Instability index | 55.35 |
| Isoelectric point | 5.39 |
| Molecular weight | 17707.72 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22404
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.22| 17| 19| 17| 35| 1
---------------------------------------------------------------------------
11- 32 (17.33/15.12) MDAtvdELSAAYKefVAAAVAV
33- 50 (25.90/14.94) MEA..rEQSGGQK..MAATDAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.52| 18| 44| 90| 107| 2
---------------------------------------------------------------------------
90- 107 (30.05/15.21) GSSSSASTPASVALAAPG
135- 152 (33.47/17.73) GGPSAAGPGGGVSTPAAG
---------------------------------------------------------------------------
|