<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22399
| Description |
Uncharacterized protein |
| Sequence | MTATANWVANGASLEDCHSNIFSLAELTGIKWRRYSFCSGGEYGPVISAPAQDDPVLRSFMHCVQANLLCVWRRKIKPDARELWIFWWGEEPDFSDVIHHELKVADEGLWECGLSYECRTLLFKAIHNLLERCLNDKGFVRIGKWFFKPHELEEKSLGSSEHLSCSFSFFLHGESNVCTSVEIVQHQPAYHITERHIRLAQTSSTPVQAVSEKACACINAIQSYCLARVHLWPFMLKSGNML |
| Length | 242 |
| Position | Middle |
| Organism | Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Cyprinodontiformes> Poeciliidae> Poeciliinae>
Xiphophorus.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.117 |
| Instability index | 50.32 |
| Isoelectric point | 6.30 |
| Molecular weight | 27607.32 |
| Publications | PubMed=23542700
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22399
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 101.62| 21| 21| 127| 147| 1
---------------------------------------------------------------------------
99- 123 (27.97/13.42) HHELK..VADEGLWECGLSYecrtllF
127- 147 (38.76/20.88) HNLLERCLNDKGFVRIGKWF......F
150- 170 (34.90/18.21) HELEEKSLGSSEHLSCSFSF......F
---------------------------------------------------------------------------
|