<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22388
| Description |
Zgc:114119 |
| Sequence | HRPEVNQAPAVTSCPGLMAAPPQQQQPPPGALREISPVFLCRIGQETVQDIVTRTMEIFQITRATQLPNGVTQSHAVYQDRFGKLQEHLRQLALLFRKLRLLYERCVEMTSDLQESPTELVPYAGEELVPVRSEPCSPAVIQERQEVLEKVRQKNQEMKFLMDQMRNLLWDVNAMLTLRK |
| Length | 180 |
| Position | Head |
| Organism | Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Cyprinodontiformes> Poeciliidae> Poeciliinae>
Xiphophorus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.416 |
| Instability index | 66.90 |
| Isoelectric point | 7.02 |
| Molecular weight | 20673.72 |
| Publications | PubMed=23542700
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22388
No repeats found
No repeats found
|