<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22386
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MEVPGADSDWRSPQFRQKVVAQIEDAMRKAGSGNTTHKSGTDMENHVFIKAKTREEYLSLVARLIIHFRDIHKKALGGADPMNALTNLTGVGGGMGMGPRPPGTAVGGMGAMGQMQLGQHAMAGVQGNPQAMGTPGQMSVQQMVQQQQQQQSMQFQQFQQAQQQQQAQQNAALQQQQQQFQQQQQLRALQQHAQNQQLQQQQHAQNQQQQNQVCPQIDPAEPAAKPSPDAFRPHSIYLRAPSLTNGAAFQLLTHSNMVAPK |
| Length | 261 |
| Position | Tail |
| Organism | Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Cyprinodontiformes> Poeciliidae> Poeciliinae>
Xiphophorus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.801 |
| Instability index | 55.72 |
| Isoelectric point | 9.61 |
| Molecular weight | 28685.92 |
| Publications | PubMed=23542700
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22386
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 177.00| 35| 35| 145| 179| 1
---------------------------------------------------------------------------
115- 142 (33.01/ 6.38) ........MQLGQHAMAgvQGNPQAMGTPG.QMSVQQ
145- 179 (65.28/20.48) QQQQQQQSMQFQQFQQA..QQQQQAQQNAALQQQQQQ
181- 204 (42.85/10.68) QQQ..Q...QLRALQQH..AQNQQ......LQQQQHA
205- 230 (35.86/ 7.62) QNQQQQNQV.CPQIDPA..EPAAKPSPDA........
---------------------------------------------------------------------------
|