<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22374

Description Uncharacterized protein
SequenceMASSMNGMFQGQQPPGAHPVGGPPGPAQPSFSGTAPRVQGNNTLVDELEASFEACFSSLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVLKEDVSDLRNELQRKELLVQKHLAKLHHWQQVLEDVSGQHRKPTDLPPPGPLAFLEQASASLPPAPLKPS
Length180
PositionHead
OrganismXiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Atherinomorphae> Cyprinodontiformes> Poeciliidae> Poeciliinae> Xiphophorus.
Aromaticity0.06
Grand average of hydropathy-0.544
Instability index48.29
Isoelectric point5.51
Molecular weight19788.10
Publications
PubMed=23542700

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22374
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.78|      13|     134|      11|      26|       1
---------------------------------------------------------------------------
   11-   26 (25.90/16.56)	GQ.QPPGAHPvggPPGP
  148-  161 (24.88/ 9.22)	GQhRKPTDLP...PPGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.34|      23|      30|      90|     113|       2
---------------------------------------------------------------------------
   90-  113 (34.68/24.63)	QTECFFLQKRLQlSVQKPEQVLKE
  123-  145 (39.67/23.93)	QRKELLVQKHLA.KLHHWQQVLED
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22374 with Med28 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MASSMNGMFQGQQPPGAHPVGGPPGPAQPSFSGTAPRVQG
1
40










Molecular Recognition Features






MoRF SequenceStartStop




NANANA