<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22368
| Description |
Uncharacterized protein |
| Sequence | MDYDFKTKLAAERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRGMVKSLLYQILDGIHYLHANWVLHRDLVTATLQCLFYTVYISSSSQKL |
| Length | 173 |
| Position | Kinase |
| Organism | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.402 |
| Instability index | 36.13 |
| Isoelectric point | 9.23 |
| Molecular weight | 20232.23 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22368
No repeats found
No repeats found
|